PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30024.m001746
Common NameRCOM_1244860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 451aa    MW: 50679.6 Da    PI: 6.8357
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30024.m001746genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS459.22.6e-140274481374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lLl+c ++v++g+le+a+ +L ++s+las +gd+mqR+aayfteALa+r+ + ++++ +al++++ +   +see+ ++klf+e++P+lk++++
  30024.m001746  27 LIHLLLTCGNHVAAGSLENAEIALGQISQLASAEGDTMQRIAAYFTEALAHRIIKAWPGVHRALNATKIT--LVSEEILVRKLFFEMFPFLKVGFV 120
                    689*************************************************************999998..7*********************** PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    ++NqaI ea+ege++vHiiD+++ +++QW+aLlqaL++R+egpp+lRiTg+++    +ke l +++++L++ Ae+l++pf+fn+ ++++le+l++e
  30024.m001746 121 ITNQAIIEAMEGEKMVHIIDLNAVEPAQWLALLQALSARREGPPHLRITGIHQ----QKEVLDQMAHKLSEEAERLDIPFQFNP-IVSKLENLDIE 211
                    *****************************************************....9**************************.7999******* PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrll.........................................................desvsleserdevLklv 231
                    +Lrvk+gEala+++vlqlh++l                                                         ++++s+  + d +L+++
  30024.m001746 212 KLRVKTGEALAISSVLQLHSFLasddelrkrspvtlknsngmhlqrvlpanqgtlgellekdmvngyspsshstsssplSSTASV--KMDYFLNTL 305
                    *************************************************************************987654333333..4699***** PP

           GRAS 232 kslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                    +slsPk++vv+eq+++hn++s++er+leal+ y+alfd+le++++r+s er kvE++l+g+ei+n+++c gaer+erhe+le+W +rl+ aGF++v
  30024.m001746 306 WSLSPKLMVVMEQDSNHNGSSLMERLLEALYSYAALFDCLESTVSRTSLERLKVEKMLFGEEIKNIISCDGAERKERHEKLERWIQRLDLAGFGNV 401
                    ************************************************************************************************ PP

           GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    pls+    qa++ll+ ++ dgyr+++e+g++v++W+drpL+s+SaWr
  30024.m001746 402 PLSYCGLLQARRLLQGYGCDGYRIKDENGCVVICWQDRPLFSLSAWR 448
                    **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.561428IPR005202Transcription factor GRAS
PfamPF035148.9E-13827448IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MMSLSPGMGS PYPWLRELKS EERGLYLIHL LLTCGNHVAA GSLENAEIAL GQISQLASAE  60
GDTMQRIAAY FTEALAHRII KAWPGVHRAL NATKITLVSE EILVRKLFFE MFPFLKVGFV  120
ITNQAIIEAM EGEKMVHIID LNAVEPAQWL ALLQALSARR EGPPHLRITG IHQQKEVLDQ  180
MAHKLSEEAE RLDIPFQFNP IVSKLENLDI EKLRVKTGEA LAISSVLQLH SFLASDDELR  240
KRSPVTLKNS NGMHLQRVLP ANQGTLGELL EKDMVNGYSP SSHSTSSSPL SSTASVKMDY  300
FLNTLWSLSP KLMVVMEQDS NHNGSSLMER LLEALYSYAA LFDCLESTVS RTSLERLKVE  360
KMLFGEEIKN IISCDGAERK ERHEKLERWI QRLDLAGFGN VPLSYCGLLQ ARRLLQGYGC  420
DGYRIKDENG CVVICWQDRP LFSLSAWRCK K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-39274484375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516708.20.0PREDICTED: scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLB9RSI90.0B9RSI9_RICCO; Transcription factor, putative
STRINGPOPTR_0009s05330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3